PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G1308
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 327aa    MW: 36715 Da    PI: 6.3727
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G1308genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-152370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ Ia+  g+ R++k+c++rw +yl
      Gh_A08G1308 23 KGLWSPEEDEKLMKYMLTNGQGCWSDIAKNAGLQRCGKSCRLRWINYL 70
                     678*******************************************97 PP

2Myb_DNA-binding52.51.1e-1676120147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E+el+++++  lG++ W+ Ia++++ gRt++++k++w++ 
      Gh_A08G1308  76 RGAFSPQEEELIIHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 120
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.7881870IPR017930Myb domain
SuperFamilySSF466897.03E-2920117IPR009057Homeodomain-like
SMARTSM007171.3E-112272IPR001005SANT/Myb domain
PfamPF002492.1E-142370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-242477IPR009057Homeodomain-like
CDDcd001678.91E-102670No hitNo description
PROSITE profilePS5129426.12671125IPR017930Myb domain
SMARTSM007171.8E-1675123IPR001005SANT/Myb domain
PfamPF002492.7E-1576120IPR001005SANT/Myb domain
CDDcd001671.50E-1178121No hitNo description
Gene3DG3DSA:1.10.10.602.5E-2678126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MRKPDPNMPK NNTSTTNKMK LRKGLWSPEE DEKLMKYMLT NGQGCWSDIA KNAGLQRCGK  60
SCRLRWINYL RPDLKRGAFS PQEEELIIHL HSILGNRWSQ IAARLPGRTD NEIKNFWNST  120
LKKRLKNNTS TSSSPNNSDS SEPRDVVGGI FPLHEHHAMT FCVDSISSSS TISMPPMVTG  180
NQFDPFPLLN INRYDITGGA AGLLDVPTCL AQGGLGEALY GDYGVLEPGK IALEGDFSLP  240
PLESRSIEES NTAINSIDRK SNNNNHHHHH NNNTCFNNTD QSFKVGEAFG LENHHWEGEN  300
LRMGEWDLEG LMDNISSFPN FLDFQVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27211255108B-MYB
1h8a_C3e-272112525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6144040.0JX614404.1 Gossypium hirsutum clone NBRI_GE57753 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475461.10.0PREDICTED: transcription factor MYB46
SwissprotQ9LXV21e-71MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A0D2R6G80.0A0A0D2R6G8_G
STRINGPOPTR_0001s27430.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70772642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.18e-89myb domain protein 83